PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC15179_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family HB-other
Protein Properties Length: 193aa    MW: 21771 Da    PI: 4.8749
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC15179_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-0910422254
                 SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54
                  ryps +++  LA+++gL+ +qV++WF N R +
  RrC15179_p1 10 LRYPSDADKHLLARQTGLSRNQVSNWFINARVR 42
                 69*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.855146IPR001356Homeobox domain
SMARTSM003890.0023250IPR001356Homeobox domain
SuperFamilySSF466897.7E-13953IPR009057Homeodomain-like
CDDcd000861.07E-101147No hitNo description
Gene3DG3DSA:1.10.10.607.1E-181252IPR009057Homeodomain-like
PfamPF059203.0E-131242IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MVKSFSGLFL RYPSDADKHL LARQTGLSRN QVSNWFINAR VRLWKPMVEE MYQQEAKERE  60
EKELEENQKE DYQQTNNSSN NNDTKPNESN FTLVQTITAQ TPTTTMMTPT PHENDSSFLP  120
PSVVTAAPHS ISDAFTAATC QQDVSDHFQV DDGVMRFGTK QAGDVSLTLG LRHTGNMPDN  180
KNASFSVRDF GDF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3528111e-149AK352811.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-02-J15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013605344.11e-108PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_013605345.11e-108PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_013605346.11e-108PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_013605348.11e-108PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL53e-66BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLA0A0D3DVS81e-108A0A0D3DVS8_BRAOL; Uncharacterized protein
STRINGBra039212.1-P3e-98(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21662466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.39e-59BEL1-like homeodomain 4